PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001274.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family BES1
Protein Properties Length: 326aa    MW: 34882.2 Da    PI: 9.0377
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001274.1_g00014.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822210.83.6e-65291591132
                   DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssa 86 
                              g+++rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg +p+  +e++g+s+
  Itr_sc001274.1_g00014.1  29 GSGRRKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCAEAGWIVEPDGTTYRKGGRPT-PMEIGGTST 113
                              6899************************************************************************.********* PP

                   DUF822  87 saspesslqsslkssalaspvesysaspksssfpspssldsislas 132
                              +++p ss + s+ ss++asp++sy++sp sss psp++ d ++++ 
  Itr_sc001274.1_g00014.1 114 NITPGSSRNPSPPSSYFASPIPSYQPSPMSSSCPSPTHGDATNVSP 159
                              ****************************************999863 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.3E-6030157IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MMWEPGGSAG SLSEAAGGAG GGEMGAGSGS GRRKPSWRER ENNRRRERRR RAIAAKIYTG  60
LRAQGNYNLP KHCDNNEVLK ALCAEAGWIV EPDGTTYRKG GRPTPMEIGG TSTNITPGSS  120
RNPSPPSSYF ASPIPSYQPS PMSSSCPSPT HGDATNVSPH PFAFLRNAIP SSLPPLRISN  180
SAPVTPPLSS PTRVPKPTFN LESLTKESMS ALNIPLFASC PTSPTRGPRF PATIPECDES  240
ETSTVDSDQW MSLQKCGPNA VPTSPTFNLV KPVAQRIPPN SMMFDKGKSI DFGFENVAMK  300
AWEGERAHEV GLDDLELKLG SGSTRI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13150RRKPSWRERENNRRRERRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-147PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-108BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A0F6VYB21e-147A0A0F6VYB2_NICBE; BES1/BZR1
STRINGSolyc04g079980.2.11e-144(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.27e-97BES1 family protein